The Invitrogen Challenge Lab
 | The Invitrogen Challenge Lab is now open! Do you have what it takes to win? Pit your skill and wits against your colleagues in our exciting games and get your name on the leaderboard! Every month starting May 1, 2010, the player with the highest score for each game will win a fantastic prize. Prize drawings will occur the last day of each month and be based upon the players combined highest score for all games played each month the contest is running. Players will be contacted through their registration email address.  |
Play Lab Racer!
 Win an Asus® Netbook featuring a widget that turns your DNA, RNA or protein sequence into a song - available exclusively from Invitrogen! Try it for yourself! Ever wonder what human AKT sounds like? Simply copy and paste in the code below: msdvaivkegwlhkrgeyiktwrpryfllknd gtfigykerpqdvdqreaplnnfsvaqcqlmk terprpntfiirclqwttviertfhvetpeer eewttaiqtvadglkkqeeeemdfrsgspsdn sgaeemevslakpkhrvtmnefeylkllgkgt fgkvilvkekatgryyamkilkkevivakdev ahtltenrvlqnsrhpfltalkysfqthdrlc fvmeyanggelffhlsrervfsedrarfygae ivsaldylhseknvvyrdlklenlmldkdghi kitdfglckegikdgatmktfcgtpeylapev ledndygravdwwglgvvmyemmcgrlpfynq dheklfelilmeeirfprtlgpeaksllsgll kkdpkqrlgggsedakeimqhrffagivwqhv yekklsppfkpqvtsetdtryfdeeftaqmit itppdqddsmecvdserrphfpqfsysasgta |
Play Culture Rush!
 | Win a Nintendo® Wii™ Sports Pack Game Console!
|
Play Brain Game!
 | Win an Apple® iPod Touch® 32 GB!
|
Terms and Conditions
ASUS is a registered trademark of ASUSTeK Computer, Inc. Nintendo and Wii are registered trademarks of Nintendo, Inc. Apple and iPod touch are registered trademarks of Apple Inc. ASUSTeK Computer, Inc. Nintendo, Inc. and Apple Inc. are is not participants in or sponsors of this promotion.
